PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G02530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 452aa    MW: 49927.4 Da    PI: 6.3984
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G02530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37e-33258312155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprlrWtpeLHerFv+av++L G+ekAtPk +l+lmkv+gLt++h+kSHLQkYRl
  OPUNC02G02530.1 258 KPRLRWTPELHERFVDAVNKLEGPEKATPKGVLKLMKVEGLTIYHIKSHLQKYRL 312
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.818255315IPR017930Myb domain
SuperFamilySSF466891.79E-17256312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-31257313IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-25258313IPR006447Myb domain, plants
PfamPF002493.9E-9260311IPR001005SANT/Myb domain
PfamPF143796.0E-22346392IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MSTQSVIAVK QFSGSDKMAH TCTAPRPSAH ILSNANSDLC GSTNSSTSLP CSIQSSNIKT  60
ELISSSSLPK ILPFNAGSNP ENSHSRMSQH EFSDPILSSS SFFCTSLYTS SSMNSGSCRK  120
NSDLLFLPHP SKFEQQQNSA GQSSSSFLSN SGHVDDEHTD DVKDFLNLSS DGSFNGKSSA  180
MAYDEQMEFQ FLSEQLGIAI TNNEESPRLD DIYDRPPQLL SLPVSSCSDQ EDLQDAGSPA  240
KVQLSSSRSS SGTASCNKPR LRWTPELHER FVDAVNKLEG PEKATPKGVL KLMKVEGLTI  300
YHIKSHLQKY RLAKYLPETK EDKKQEEKKA KSVANGNDHV KKKSAQMAEA LRMQMEVQKQ  360
LHEQLEVQRQ LQLRIEEHAR YLQKILEEQQ KARESISSTM TSTTEGESPE FAPKEKTEDK  420
AETSSAPLSK YRISDTDAEC HSQVDNKKTA AG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0657040.0AK065704.1 Oryza sativa Japonica Group cDNA clone:J013037C19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627390.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015627391.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLA0A0E0JVC50.0A0A0E0JVC5_ORYPU; Uncharacterized protein
STRINGLOC_Os02g04640.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0030200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-61G2-like family protein